{"product_id":"proteintech-30623-1-ap","title":"Proteintech, 30623-1-AP, PIGP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIGP (30623-1-AP) by Proteintech is a Polyclonal antibody targeting PIGP in IP, ELISA applications with reactivity to human samples\n30623-1-AP targets PIGP in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphatidylinositol glycan anchor biosynthesis, class P (PIGP), a member of the large glycosylphosphatidylinositol (GPI) anchor biosynthesis gene family, encodes a subunit of the enzyme that catalyzes the first step of GPI anchor biosynthesis (PMID: 28334793). Mutations in the PIGP gene can lead to a variety of disorders, including developmental delay, intellectual disability, seizures, dysmorphic features, and diverse congenital anomalies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29498 Product name: Recombinant human PIGP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 70-134 aa of BC005180 Sequence: YVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN Predict reactive species\nFull Name: phosphatidylinositol glycan anchor biosynthesis, class P\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 15~18 kDa\nGenBank Accession Number: BC005180\nGene Symbol: PIGP\nGene ID (NCBI): 51227\nRRID: AB_3669740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57054\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887762624681,"sku":"30623-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30623-1-ap","provider":"Iright","version":"1.0","type":"link"}