{"product_id":"proteintech-30625-1-ap","title":"Proteintech, 30625-1-AP, CACNA1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CACNA1B (30625-1-AP) by Proteintech is a Polyclonal antibody targeting CACNA1B in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n30625-1-AP targets CACNA1B in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, Y79 cells\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCACNA1B, also named CACH5, CACNL1A5, and BIII, belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division, and cell death. CACNA1B gives rise to N-type calcium currents. N-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by omega-conotoxin-GVIA (omega-CTx-GVIA) and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to dihydropyridines (DHP), and omega-agatoxin-IVA (omega-Aga-IVA). CACNA1B may play a role in the directed migration of immature neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33516 Product name: Recombinant human CACNA1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1841-1995 aa of NM_000718 Sequence: VPPHKPDEMTVGKVYAALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHEARPPLERGHSTEIPVGRSGALAVDVQMQSITRRGPDGEPQPGLES Predict reactive species\nFull Name: calcium channel, voltage-dependent, N type, alpha 1B subunit\nCalculated Molecular Weight: 262 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: NM_000718\nGene Symbol: CACNA1B\nGene ID (NCBI): 774\nRRID: AB_3669741\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00975\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885727076521,"sku":"30625-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30625-1-ap","provider":"Iright","version":"1.0","type":"link"}