{"product_id":"proteintech-30648-1-ap","title":"Proteintech, 30648-1-AP, CTLA-4\/CD152 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTLA-4\/CD152 (30648-1-AP) by Proteintech is a Polyclonal antibody targeting CTLA-4\/CD152 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n30648-1-AP targets CTLA-4\/CD152 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Con A treated mouse splenocytes\nPositive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTLA-4, also known as CD152, belonging to the immunoglobulin superfamily, is primarily found on activated T cells and regulatory T cells (Tregs). CTLA-4 is closely related to the T-cell costimulatory CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells. CTLA-4 acts as a negative regulatory molecule of T-cell responses. Besides the full-length transmembrane form, CTLA-4 also exists in a truncated soluble form (sCTLA-4).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0632 Product name: Recombinant Mouse CTLA-4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 36-162 aa of NM_009843.4 Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF Predict reactive species\nFull Name: cytotoxic T-lymphocyte-associated protein 4\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 28-40 kDa\nGenBank Accession Number: NM_009843.4\nGene Symbol: CTLA-4\nGene ID (NCBI): 12477\nRRID: AB_3086380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09793\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869665054889,"sku":"30648-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30648-1-ap","provider":"Iright","version":"1.0","type":"link"}