{"product_id":"proteintech-30684-1-ap","title":"Proteintech, 30684-1-AP, Dnmt3c Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Dnmt3c (30684-1-AP) by Proteintech is a Polyclonal antibody targeting Dnmt3c in WB, ELISA applications with reactivity to human, mouse, rat samples\n30684-1-AP targets Dnmt3c in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNMT3C is highly specialized at methylating young retrotransposon promoters in the male germ line. In comparison, DNMT3B is not involved in germ cell development but establishes somatic methylation patterns genome-wide in the early embryo. DNMT3C has therefore evolved its own regulatory pattern and genomic targets, which have diverged from the ancestral DNMT3B copy. Despite the strict requirement of DNMT3C in the mouse, the Dnmt3C duplication is not universal among mammals but occurred ~46 million years ago in the last common ancestor of the muroid rodents. (PMID: 27856912)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33470 Product name: Recombinant mouse Dnmt3c protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of Sequence: MRGGSRHLSNEEDVSGCEDCIIISGTCSDQSSDPKTVPLTQVLEAVCTVENRGCRTSSQPSKRKASSLISYVQDLTGDGDEDRDGEVGGSSGSGTPVMPQLFCETRIPSKTPAPLSWQANTSASTPWLSPASPYPIIDLTDEDVIPQSISTPSVDWSQDS Predict reactive species\nFull Name: predicted gene, OTTMUSG00000016816\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 70 kDa\nGene Symbol: OTTMUSG00000016816\nGene ID (NCBI): 668932\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0DOY1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887273070761,"sku":"30684-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30684-1-ap","provider":"Iright","version":"1.0","type":"link"}