{"product_id":"proteintech-30694-1-ap","title":"Proteintech, 30694-1-AP, ESR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESR2 (30694-1-AP) by Proteintech is a Polyclonal antibody targeting ESR2 in WB, ELISA applications with reactivity to Human samples\n30694-1-AP targets ESR2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, PC-3 cells,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEstrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoform and range of calculated molecular weight of isoforms is 50-60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33524 Product name: Recombinant human ESR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC024181 Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCS Predict reactive species\nFull Name: estrogen receptor 2 (ER beta)\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC024181\nGene Symbol: ESR2\nGene ID (NCBI): 2100\nRRID: AB_3086390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628210345,"sku":"30694-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30694-1-ap","provider":"Iright","version":"1.0","type":"link"}