{"product_id":"proteintech-30713-1-ap","title":"Proteintech, 30713-1-AP, ADRB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADRB3 (30713-1-AP) by Proteintech is a Polyclonal antibody targeting ADRB3 in WB, ELISA applications with reactivity to Human samples\n30713-1-AP targets ADRB3 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta-3 adrenergic receptor(ADRB3), a member of the G-protein-coupled receptor family, is expressed mainly in adipose tissue and is thought to contribute to lipolysis and thermogenesis. In addition, the overexpression of ADRB3 has been found in several cancer types, including breast cancer, gallbladder cancer , and colorectal cancer. More recently, the involvement of ADRB3 in the metabolic reprogramming of melanoma, the promotion of immune tolerance, and the regulation of cancer differentiation have been described. (PMID: 32514619)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31466 Product name: Recombinant human ADRB3 protein Source: e coli. -derived, pet43.1a Tag: NUS+HIS Domain: 179-292 aa of NM_000025 Sequence: RVGADAEAQRCHSNPRCCAFASNMPYVLLSSSVSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPARLLPLREHRALC Predict reactive species\nFull Name: adrenergic, beta-3-, receptor\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44-50 kDa\nGenBank Accession Number: NM_000025\nGene Symbol: ADRB3\nGene ID (NCBI): 155\nRRID: AB_3086396\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13945\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869804220585,"sku":"30713-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30713-1-ap","provider":"Iright","version":"1.0","type":"link"}