{"product_id":"proteintech-30732-1-ap","title":"Proteintech, 30732-1-AP, RNASE4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNASE4 (30732-1-AP) by Proteintech is a Polyclonal antibody targeting RNASE4 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30732-1-AP targets RNASE4 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk, THP-1 cells\nPositive IHC detected in: rat lung tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman Ribonuclease 4 (RNase 4), one of the eight members of the human RNase A superfamily of endoribonucleases, is a uridine-specific endoribonuclease with a preference to cleave RNA after uridine residues prior to purines (PMID: 33818125). RNase 4 is a newly identified host defense peptide in the human kidney and bladder and kills uropathogenic E. coli (UPEC) and multi-drug resistant UPEC (PMID: 28955965).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29272 Product name: Recombinant human RNASE4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-147 aa of BC015520 Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG Predict reactive species\nFull Name: ribonuclease, RNase A family, 4\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC015520\nGene Symbol: RNASE4\nGene ID (NCBI): 6038\nRRID: AB_3086405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P34096\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887785726121,"sku":"30732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30732-1-ap","provider":"Iright","version":"1.0","type":"link"}