{"product_id":"proteintech-30733-1-ap","title":"Proteintech, 30733-1-AP, FAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAT1 (30733-1-AP) by Proteintech is a Polyclonal antibody targeting FAT1 in WB, IHC, ELISA applications with reactivity to human samples\n30733-1-AP targets FAT1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAT1, also known as hFat1, belongs to a member of the cadherin superfamily, has been proposed to play roles in cerebral development, glomerular slit formation, and also to act as a tumor suppressor, but its mechanisms of action have not been elucidated. It is expected to be located in cell membrane and nucleus, which is expressed in many epithelial and some endothelial and smooth muscle cells. The calculated molecular weight of FAT1 is 506 kDa and there is glycosylation modification of the protein. To examine functions of the transmembrane and cytoplasmic domains, they were expressed in HEK-293 and HeLa cells as chimeric proteins in fusion with EGFP and extracellular domains derived from E-cadherin. Proteins comprising the transmembrane domain localized to the membrane fraction (PMID: 15922730, 26373379).The high molecular mass band observed at the expected 500-kDa size of FAT1 is indicated by an arrow together with a prominent band at 85 kDa (PMID: 21680732).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33957 Product name: Recombinant human FAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4390-4550 aa of Sequence: PSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVS Predict reactive species\nFull Name: FAT tumor suppressor homolog 1 (Drosophila)\nObserved Molecular Weight: 506-600 kDa\nGene Symbol: FAT1\nGene ID (NCBI): 2195\nRRID: AB_3086406\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14517\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635386537,"sku":"30733-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30733-1-ap","provider":"Iright","version":"1.0","type":"link"}