{"product_id":"proteintech-30735-1-ap","title":"Proteintech, 30735-1-AP, SHLD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHLD3 (30735-1-AP) by Proteintech is a Polyclonal antibody targeting SHLD3 in WB, ELISA applications with reactivity to human, mouse samples\n30735-1-AP targets SHLD3 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHLD3 (shieldin complex subunit 3), also known as RINN1 or CTC-534A2.2. It is located in Chromosome and expressed in monocyte. The gene is a component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). It has been found that the proper function of MAD2L2 in shieldin requires its dimerization, and the interaction between MAD2L2 and SHLD3 is mediated and accelerated by SHLD2. The dimerization defect MAD2L2 damages the assembly of shieldin and cannot promote the NHEJ. In addition, the dimerization of MAD2L2 and the existence of SHLD3 allow shieldin to interact with TRIP13 ATPase (PMID: 34521823). The calculated molecular weight of SHLD3 is 28 kDa, the antibody can recognize the 70kDa band, which may be related to the interaction between MAD2L2 and SHLD3 as a dimer in shieldin complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32940 Product name: Recombinant human SHLD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of Sequence: MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM Predict reactive species\nFull Name: SHLD3\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 28-70 kDa\nGene Symbol: SHLD3\nGene ID (NCBI): 112441434\nRRID: AB_3086407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZNX1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887801290921,"sku":"30735-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30735-1-ap","provider":"Iright","version":"1.0","type":"link"}