{"product_id":"proteintech-30761-1-ap","title":"Proteintech, 30761-1-AP, FAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAF2 (30761-1-AP) by Proteintech is a Polyclonal antibody targeting FAF2 in WB, ELISA applications with reactivity to Human samples\n30761-1-AP targets FAF2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein ETEA (FAF2, or UBXD8) is a homolog to Fas-associated factor 1 (FAF1), which is involved in Fas-mediated apoptosis. ETEA protein directly interacts with and negatively regulates neurofibromin. ETEA contains both UBA and UBX domains and overexpression of ETEA downregulates neurofibromin in human cells. It may play a role in the translocation of terminally misfolded proteins from the endoplasmic reticulum lumen to the cytoplasm and their degradation by the proteasome. ETEA is highly expressed in peripheral blood of patients with atopic dermatitis (AD) compared to normal individuals, and may regulate the resistance to apoptosis that is observed in T cells and eosinophils of AD patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33251 Product name: Recombinant human FAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-445 aa of BC014001 Sequence: LKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEVLFVQDLTDE Predict reactive species\nFull Name: Fas associated factor family member 2\nCalculated Molecular Weight: 445 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC014001\nGene Symbol: FAF2\nGene ID (NCBI): 23197\nRRID: AB_3086412\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629684905,"sku":"30761-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30761-1-ap","provider":"Iright","version":"1.0","type":"link"}