{"product_id":"proteintech-30774-1-ap","title":"Proteintech, 30774-1-AP, KIF15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF15 (30774-1-AP) by Proteintech is a Polyclonal antibody targeting KIF15 in WB, ELISA applications with reactivity to human samples\n30774-1-AP targets KIF15 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cels,  K-562 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. It is located in the cytoplasm and biased expression in testis. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15 (14618103). It is known that KIF15 participates in important events during neuronal development and involves multiple cellular processes such as proliferation, apoptosis, and differentiation. There is emerging evidence indicating that KIF15 plays an important role in several malignancies including pancreatic cancer, hepatocellular carcinoma, and breast cancer (PMID: 33277366).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33897 Product name: Recombinant human KIF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1050 aa of NM_020242 Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR Predict reactive species\nFull Name: kinesin family member 15\nCalculated Molecular Weight: 160 kDa\nObserved Molecular Weight: 145-150 kDa\nGenBank Accession Number: NM_020242\nGene Symbol: KIF15\nGene ID (NCBI): 56992\nRRID: AB_3086416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS87\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696040105,"sku":"30774-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30774-1-ap","provider":"Iright","version":"1.0","type":"link"}