{"product_id":"proteintech-30790-1-ap","title":"Proteintech, 30790-1-AP, Cathepsin C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin C (30790-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30790-1-AP targets Cathepsin C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCathepsin C, also known as DPP-I. It is expected to be located in lysosome and highly expressed in lung, kidney and placenta (PMID: 9092576). This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. The calculated molecular weight of Cathepsin C is 51 kDa. The 23-kDa band may be a subunit of the protein monomer, while a 100-kda band is a dimer form (PMID: 26884336, 31557781).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32420 Product name: Recombinant human Cathepsin C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-463 aa of NM_001814 Sequence: LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL Predict reactive species\nFull Name: cathepsin C\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: NM_001814\nGene Symbol: Cathepsin C\nGene ID (NCBI): 1075\nRRID: AB_3086417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53634\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885841404073,"sku":"30790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30790-1-ap","provider":"Iright","version":"1.0","type":"link"}