{"product_id":"proteintech-30798-1-ap","title":"Proteintech, 30798-1-AP, CD300LD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD300LD (30798-1-AP) by Proteintech is a Polyclonal antibody targeting CD300LD in WB, ELISA applications with reactivity to human samples\n30798-1-AP targets CD300LD in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MCF-7 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD300LD, also known as CD300D and CMRF35A4, is a member of the CD300 family. The CD300 family of molecules modulates a broad and diverse range of immune cell processes via their paired activating and inhibitory receptor functions. CD300LD is a 194 amino acid single-pass type I membrane protein containing an Ig-like V-type (immunoglobulin-like) domain. The apparent molecular weight is greater than the calculated molecular weight of 22 kDa, probably due to post-translational modification, presumably by glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29307 Product name: Recombinant human CD300LD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-194 aa of NM_001115152 Sequence: VTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS Predict reactive species\nFull Name: CD300 molecule-like family member d\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: NM_001115152\nGene Symbol: CD300LD\nGene ID (NCBI): 100131439\nRRID: AB_3669758\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXZ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886206898345,"sku":"30798-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30798-1-ap","provider":"Iright","version":"1.0","type":"link"}