{"product_id":"proteintech-30844-1-ap","title":"Proteintech, 30844-1-AP, C19orf63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C19orf63 (30844-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf63 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30844-1-AP targets C19orf63 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  MG-63 cells\nPositive IHC detected in: human liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEMC10 (Endoplasmic Reticulum Membrane Protein Complex Subunit 10) is one of the key components of the highly conserved endoplasmic reticulum membrane protein complex (EMC). The core function of this complex is to act as an insertase and chaperone in the endoplasmic reticulum, assisting in the correct folding, assembly, and membrane integration of membrane proteins, and preventing the aggregation of misfolded proteins. Studies have shown that EMC10 plays a dual role in cells: within the cell, it ensures the biogenesis of important membrane proteins such as G protein-coupled receptors (GPCRs); moreover, it can be secreted outside the cell (referred to as sEMC10), where it acts as a novel signaling molecule to activate the hypothalamic-pituitary axis, regulating energy metabolism and body weight in the body, and is closely related to obesity and metabolic diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34064 Product name: Recombinant human C19orf63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC035001 Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYW Predict reactive species\nFull Name: chromosome 19 open reading frame 63\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC035001\nGene Symbol: C19orf63\nGene ID (NCBI): 284361\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5UCC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885504254121,"sku":"30844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30844-1-ap","provider":"Iright","version":"1.0","type":"link"}