{"product_id":"proteintech-30906-1-ap","title":"Proteintech, 30906-1-AP, TNIK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNIK (30906-1-AP) by Proteintech is a Polyclonal antibody targeting TNIK in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30906-1-AP targets TNIK in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 205 cells, HT-29 cells,  K-562 cells\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNIK (Traf2- and Nck-interacting kinase) is one of the germinal center kinase family members involved in cytoskeleton organization and neuronal dendrite extension, which had been implicated in postsynaptic signaling as well as in regulation of cell proliferation. TNiK is expressed in the nervous system and plays key roles at the synapse and nucleus, In non-neuronal cells, TNiK has been described as a critical component of transcriptional regulatory mechanisms, mediated by Wnt signaling (PMID: 24566388). TNIK is also an essential regulatory component of the T-cell factor-4 and β-catenin transcriptional complex and is required for the tumor-initiating function of colorectal cancer stem cells (PMID: 10521462). Western blot analysis detected TNIK at an apparent molecular mass of 150~180 kDa as cited in literature (PMID: 24566388).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34132 Product name: Recombinant human TNIK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 585-636 aa of BC150256 Sequence: LRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP Predict reactive species\nFull Name: TRAF2 and NCK interacting kinase\nObserved Molecular Weight: 155~180 kDa\nGenBank Accession Number: BC150256\nGene Symbol: TNIK\nGene ID (NCBI): 23043\nRRID: AB_3669779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UKE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834714281,"sku":"30906-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30906-1-ap","provider":"Iright","version":"1.0","type":"link"}