{"product_id":"proteintech-30911-1-ap","title":"Proteintech, 30911-1-AP, KCNJ18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNJ18 (30911-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ18 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples\n30911-1-AP targets KCNJ18 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue\nPositive IF-P detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMutations in KCNJ18 gene encoding an inwardly rectifying potassium channel (Kir2.6) cause thyrotoxic periodic paralysis (TPP) and sporadic, that is, non-familial cases of HypoPP. Mutant Kir2.6 proteins form a heterotetrameric Kir channel complex with Kir2.1 and thereby reduce cell surface expression of the complex. (PMID: 25882930)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34177 Product name: Recombinant human KCNJ18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 353-433 aa of NM_001194958 Sequence: STPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRGSEI Predict reactive species\nFull Name: similar to hkir2.2x\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_001194958\nGene Symbol: KCNJ18\nGene ID (NCBI): 100134444\nRRID: AB_3669782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: B7U540\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887691321513,"sku":"30911-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30911-1-ap","provider":"Iright","version":"1.0","type":"link"}