{"product_id":"proteintech-30948-1-ap","title":"Proteintech, 30948-1-AP, KIM-1\/HAVCR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIM-1\/HAVCR1 (30948-1-AP) by Proteintech is a Polyclonal antibody targeting KIM-1\/HAVCR1 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n30948-1-AP targets KIM-1\/HAVCR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IHC detected in: rat kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKidney injury molecule 1 (KIM-1), also known as Hepatitis A virus cellular receptor 1 (HAVCR1), CD365, or T-cell immunoglobulin and mucin domain 1 (TIM-1), is a class I integral membrane glycoprotein, with an ectodomain containing Ig-like domain and a mucin domain. KIM-1 acts as a membrane receptor for hepatitis A virus (HAV) (PMID: 9658108; 8861957). KIM-1 provides a costimulatory signal for T cell activation and inhibits the development of peripheral tolerance (PMID: 16284246; 15793575). KIM-1 may be involved in the regulation of asthma and allergic diseases (PMID: 14534576). It has been reported that KIM-1 is shed into urine after acute kidney damage and is a marker of renal tubular injury (PMID: 14600030).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0597 Product name: Recombinant Rat KIM-1\/HAVCR1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 18-238 aa of NM_173149.2 Sequence: SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV Predict reactive species\nFull Name: hepatitis A virus cellular receptor 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: NM_173149.2\nGene Symbol: Havcr1\nGene ID (NCBI): 286934\nRRID: AB_3669790\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O54947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898054313,"sku":"30948-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30948-1-ap","provider":"Iright","version":"1.0","type":"link"}