{"product_id":"proteintech-30957-1-ap","title":"Proteintech, 30957-1-AP, MIF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIF (30957-1-AP) by Proteintech is a Polyclonal antibody targeting MIF in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to mouse, rat samples\n30957-1-AP targets MIF in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: J774A.1 cells, NIH\/3T3 cells,  Neuro-2a cells,  RAW 264.7 cells,  C6 cells,  mouse brain tissue,  mouse kidney tissue\nPositive IF\/ICC detected in: Neuro-2a cells, NIH\/3T3 cells\nPositive FC (Intra) detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0574 Product name: Recombinant mouse MIF protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 2-115 aa of NM_010798.2 Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA Predict reactive species\nFull Name: macrophage migration inhibitory factor\nCalculated Molecular Weight: 13KD\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: NM_010798.2\nGene Symbol: Mif\nGene ID (NCBI): 17319\nRRID: AB_3086428\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P34884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869709881513,"sku":"30957-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30957-1-ap","provider":"Iright","version":"1.0","type":"link"}