{"product_id":"proteintech-30959-1-ap","title":"Proteintech, 30959-1-AP, TLE4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLE4 (30959-1-AP) by Proteintech is a Polyclonal antibody targeting TLE4 in WB, IP, ELISA applications with reactivity to human, mouse samples\n30959-1-AP targets TLE4 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  Neuro-2 cells\nPositive IP detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLE4 (Transducin-like enhancer protein 4), also known as GRG4. It is predicted to be located in the nucleus. Tle4 promotes acquisition of corticothalamic identity and blocks emergence of core characteristics of subcerebral\/corticospinal projection neuron identity, including gene expression and connectivity. During the first post-natal week, when corticothalamic innervation is ongoing, Tle4 is required to stabilize corticothalamic neuron identity, limiting interference from differentiation programs of developmentally related neuron classes (PMID: 37561632). The molecular weight of TLE4 is 76 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34006 Product name: Recombinant human TLE4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-408 aa of BC059405 Sequence: LDKTRLLKKDAPISPASIASSSSTPSSKSKELSLKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFMNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGI Predict reactive species\nFull Name: transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila)\nCalculated Molecular Weight: 84 kDa\nObserved Molecular Weight: 76-88 kDa\nGenBank Accession Number: BC059405\nGene Symbol: TLE4\nGene ID (NCBI): 7091\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q04727\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887828881577,"sku":"30959-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30959-1-ap","provider":"Iright","version":"1.0","type":"link"}