{"product_id":"proteintech-30963-1-ap","title":"Proteintech, 30963-1-AP, AGTR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AGTR2 (30963-1-AP) by Proteintech is a Polyclonal antibody targeting AGTR2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n30963-1-AP targets AGTR2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAGTR2 (angiotensin II type 2 receptor) is part of the renin-angiotensin signaling (RAS) pathway that has been widely studied for its role in blood pressure regulation and renal and cardiovascular health (PMID: 29937318). AGTR2 mediates the effects of angiotensin II on cellular differentiation and growth (PMID: 30455538).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33887 Product name: Recombinant human AGTR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of NM_000686 Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD Predict reactive species\nFull Name: angiotensin II receptor, type 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: NM_000686\nGene Symbol: AGTR2\nGene ID (NCBI): 186\nRRID: AB_3669797\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P50052\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805465769,"sku":"30963-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30963-1-ap","provider":"Iright","version":"1.0","type":"link"}