{"product_id":"proteintech-30990-1-ap","title":"Proteintech, 30990-1-AP, RBM12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM12 (30990-1-AP) by Proteintech is a Polyclonal antibody targeting RBM12 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30990-1-AP targets RBM12 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNA binding motif protein 12 (RBM12) is a member of the RBM family. RBM proteins are involved in RNA metabolism, including splicing, transport, translation and stability. RBM12 has been identified as a key protein that increases the expression of PD-L1, thereby promoting immune evasion in hepatocellular carcinoma (PMID: 39187545).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34621 Product name: Recombinant human RBM12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-932 aa of BC013981 Sequence: GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG Predict reactive species\nFull Name: RNA binding motif protein 12\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC013981\nGene Symbol: RBM12\nGene ID (NCBI): 10137\nRRID: AB_3669810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NTZ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780024489,"sku":"30990-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30990-1-ap","provider":"Iright","version":"1.0","type":"link"}