{"product_id":"proteintech-30991-1-ap","title":"Proteintech, 30991-1-AP, PCYT1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCYT1A (30991-1-AP) by Proteintech is a Polyclonal antibody targeting PCYT1A in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n30991-1-AP targets PCYT1A in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  mouse testis tissue,  rat testis tissue,  ARPE-19 cells,  Y79 cells\nPositive IF\/ICC detected in: U-251 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCYT1A (phosphate cytidylyltransferase 1A, choline), also known as CTPCT. It is expected to be located in the nucleus and cytoplasm, which is enriched in brain, placenta, liver, fetal and adult lung. This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. The molecular weight of PCYT1A is 41 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34268 Product name: Recombinant human PCYT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of NM_005017 Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP Predict reactive species\nFull Name: phosphate cytidylyltransferase 1, choline, alpha\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 40-41 kDa\nGenBank Accession Number: NM_005017\nGene Symbol: PCYT1A\nGene ID (NCBI): 5130\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P49585\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887754399913,"sku":"30991-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-30991-1-ap","provider":"Iright","version":"1.0","type":"link"}