{"product_id":"proteintech-31030-1-ap","title":"Proteintech, 31030-1-AP, SVEP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SVEP1 (31030-1-AP) by Proteintech is a Polyclonal antibody targeting SVEP1 in WB, ELISA applications with reactivity to human samples\n31030-1-AP targets SVEP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, SMMC-7721 cells,  human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSVEP1 (C9orf13), which is predicted to be located in the cell membrane, nucleus and cytoplasm. The protein is expressed in the whole epidermis, especially in the basal layer of epidermis, the upper and lower layers of basal layer and dermal fibroblasts in the upper dermis (PMID:27892606). At the same time, it is highly expressed in placenta, lung, adrenal gland and cerebellum, but weakly expressed in heart and skeletal muscle (PMID:11062057, PMID:27892606). The molecular weight of SVEP1 is 390 kDa. At the same time, it also has several isomers of 96kDa, 163kDa and 170kDa, and there are also glycosylation modifications. It is reported that the molecular weight is 460 kDa (PMID: 32371982). The protein may plays a role in initial cell attachment of stromal osteogenic cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34316 Product name: Recombinant human SVEP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 736-900 aa of NM_153366 Sequence: GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDIDCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS Predict reactive species\nFull Name: sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1\nCalculated Molecular Weight: 390 kDa\nObserved Molecular Weight: 460 kDa\nGenBank Accession Number: NM_153366\nGene Symbol: SVEP1\nGene ID (NCBI): 79987\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q4LDE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820099753,"sku":"31030-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31030-1-ap","provider":"Iright","version":"1.0","type":"link"}