{"product_id":"proteintech-31031-1-ap","title":"Proteintech, 31031-1-AP, SLC46A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC46A3 (31031-1-AP) by Proteintech is a Polyclonal antibody targeting SLC46A3 in IHC, ELISA applications with reactivity to Human, mouse samples\n31031-1-AP targets SLC46A3 in IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 46 member 3 (SLC46A3) is a lysosomal membrane protein that belongs to the SLC46A family. SLC46A3 has been reported to be a proton-coupled, steroid conjugate, and bile acid transporter (PMID: 36741448). SLC46A3 plays an important role  in Trastuzumab emtansine (T-DM1)  treatment, a successful noncleavable antibody-drug conjugates (ADC) (PMID: 36741448).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34359 Product name: Recombinant human SLC46A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-73 aa of BC060850 Sequence: QYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFN Predict reactive species\nFull Name: solute carrier family 46, member 3\nCalculated Molecular Weight: 463 aa, 52 kDa\nGenBank Accession Number: BC060850\nGene Symbol: SLC46A3\nGene ID (NCBI): 283537\nRRID: AB_3669822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z3Q1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887807189161,"sku":"31031-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31031-1-ap","provider":"Iright","version":"1.0","type":"link"}