{"product_id":"proteintech-31038-1-ap","title":"Proteintech, 31038-1-AP, INTS8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INTS8 (31038-1-AP) by Proteintech is a Polyclonal antibody targeting INTS8 in WB, ELISA applications with reactivity to Human samples\n31038-1-AP targets INTS8 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrator complex subunit 8 (INTS8) is one of the major components of RNA polymerase II and has been demonstrated to be involved in the cleavage of small nuclear RNAs and transcriptional processes (PMID: 34880328). INTS8 was robustly increased in neurodevelopmental diseases and numerous tumors. High INTS8 expression has a tight correlation with poor prognosis in multi-cancers (PMID: 30881114). Western blot analysis detected INTS8 at an apparent molecular mass of 111 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34627 Product name: Recombinant human INTS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 896-995 aa of BC136754 Sequence: QVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF Predict reactive species\nFull Name: integrator complex subunit 8\nCalculated Molecular Weight: 111 kDa\nObserved Molecular Weight: 111 kDa\nGenBank Accession Number: BC136754\nGene Symbol: INTS8\nGene ID (NCBI): 55656\nRRID: AB_3669824\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q75QN2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887685718185,"sku":"31038-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31038-1-ap","provider":"Iright","version":"1.0","type":"link"}