{"product_id":"proteintech-31048-1-ap","title":"Proteintech, 31048-1-AP, Histone H2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H2B (31048-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, ELISA applications with reactivity to Human, mouse samples\n31048-1-AP targets Histone H2B in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Histone H2BC1 is testis specific.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33975 Product name: Recombinant human HIST1H2BA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC066242 Sequence: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species\nFull Name: histone cluster 1, H2ba\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC066242\nGene Symbol: Histone H2B\nGene ID (NCBI): 255626\nRRID: AB_3669832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96A08\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668351145,"sku":"31048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31048-1-ap","provider":"Iright","version":"1.0","type":"link"}