{"product_id":"proteintech-31067-1-ap","title":"Proteintech, 31067-1-AP, NLRC5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NLRC5 (31067-1-AP) by Proteintech is a Polyclonal antibody targeting NLRC5 in WB, IHC, ELISA applications with reactivity to human samples\n31067-1-AP targets NLRC5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN gamma treated THP-1 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34508 Product name: Recombinant human NLRC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC063566 Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR Predict reactive species\nFull Name: NLR family, CARD domain containing 5\nCalculated Molecular Weight: 204 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: BC063566\nGene Symbol: NLRC5\nGene ID (NCBI): 84166\nRRID: AB_3669840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86WI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887738835113,"sku":"31067-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31067-1-ap","provider":"Iright","version":"1.0","type":"link"}