{"product_id":"proteintech-31069-1-ap","title":"Proteintech, 31069-1-AP, SLC22A10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A10 (31069-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A10 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n31069-1-AP targets SLC22A10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, PC-12 cells,  mouse kidney tissue,  mouse liver tissue,  rat kidney tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOrganic anion transporter 5 (OAT5), also known as SLC22A10, belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of endogenous and exogenous organic ions (PMID: 20865662). Rare variants in SLC22A10 may be associated with Alzheimer's disease CSF profile of neuronal injury and inflammation (PMID: 35173266).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34521 Product name: Recombinant human SLC22A10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-349 aa of NM_001039752 Sequence: ESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKR Predict reactive species\nFull Name: solute carrier family 22, member 10\nCalculated Molecular Weight: 541 aa, 60 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001039752\nGene Symbol: SLC22A10\nGene ID (NCBI): 387775\nRRID: AB_3669842\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q63ZE4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803977897,"sku":"31069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31069-1-ap","provider":"Iright","version":"1.0","type":"link"}