{"product_id":"proteintech-31075-1-ap","title":"Proteintech, 31075-1-AP, ADAMTS14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAMTS14 (31075-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS14 in WB, ELISA applications with reactivity to human samples\n31075-1-AP targets ADAMTS14 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, K-562 cells,  HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADAMTS (a disintegrin-like and metalloproteinase with thrombospondin motifs) is a family of extracellular metalloproteinases mediating diverse functions including matrix degradation, blood coagulation, and angiogenesis. The ADAMTS family constitutes a group of proteins composed of 19 enzymes and 7 ADAMTS-like proteins. ADAMTS14 possesses high similarity with ADAMTS2 and ADAMTS3 in sequence and domain composition (PMID: 11741898). The expression of ADAMTS14  is correlated with the occurrence and progression of colorectal cancer and oral squamous cell carcinoma (PMID: 34856162; PMID: 32102222).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34638 Product name: Recombinant human ADAMTS14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1086-1223 aa of NM_080722 Sequence: HRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKPTGSEDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPEDKGQPGEDLRHPGTSLPAASPVT Predict reactive species\nFull Name: ADAM metallopeptidase with thrombospondin type 1 motif, 14\nCalculated Molecular Weight: 134 kDa\nObserved Molecular Weight: 134 kDa\nGenBank Accession Number: NM_080722\nGene Symbol: ADAMTS14\nGene ID (NCBI): 140766\nRRID: AB_3669843\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WXS8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802582185,"sku":"31075-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31075-1-ap","provider":"Iright","version":"1.0","type":"link"}