{"product_id":"proteintech-31095-1-ap","title":"Proteintech, 31095-1-AP, Nesprin1\/Syne-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Nesprin1\/Syne-1 (31095-1-AP) by Proteintech is a Polyclonal antibody targeting Nesprin1\/Syne-1 in WB, ELISA applications with reactivity to human, mouse samples\n31095-1-AP targets Nesprin1\/Syne-1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U2OS cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYNE1, also known as spectrin repeat containing nuclear envelope protein 1. It is expressed in skeletal and smooth muscle, as well as peripheral blood lymphocytes, and localizes to the nuclear membrane. Mutations in the SYNE1 gene have been associated with several diseases, including autosomal recessive spinocerebellar ataxia type 8 (also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce) and Emery-Dreifuss muscular dystrophy 4, autosomal dominant. The SYNE1 gene exhibits ubiquitous expression across various tissues, including the ovary and bone marrow. The molecular weight of the SYNE1 protein can vary depending on the specific isoform. For example, the full-length nesprin-1 isoform, also known as nesprin-1 giant, has 8797 amino acids and a molecular weight of approximately 1000 kDa. Another isoform, nesprin-1α2, has a molecular weight of about 120 kDa (PMID: 27782104). The protein has other isoforms with molecular weights of 380 kDa, 167 kDa and 642 kDa respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34809 Product name: Recombinant human SYNE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8260-8450 aa of BC039121 Sequence: SLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLN Predict reactive species\nFull Name: spectrin repeat containing, nuclear envelope 1\nObserved Molecular Weight: 120 kDa, 367 kDa, 642 kDa, 1000 kDa\nGenBank Accession Number: BC039121\nGene Symbol: SYNE1\nGene ID (NCBI): 23345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NF91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887734902953,"sku":"31095-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31095-1-ap","provider":"Iright","version":"1.0","type":"link"}