{"product_id":"proteintech-31102-1-ap","title":"Proteintech, 31102-1-AP, SP100 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SP100 (31102-1-AP) by Proteintech is a Polyclonal antibody targeting SP100 in WB, ELISA applications with reactivity to Human samples\n31102-1-AP targets SP100 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35193 Product name: Recombinant human SP100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-300 aa of BC011562 Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK Predict reactive species\nFull Name: SP100 nuclear antigen\nCalculated Molecular Weight: 879 aa, 100 kDa\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: BC011562\nGene Symbol: SP100\nGene ID (NCBI): 6672\nRRID: AB_3669856\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P23497\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812563113,"sku":"31102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31102-1-ap","provider":"Iright","version":"1.0","type":"link"}