{"product_id":"proteintech-31182-1-ap","title":"Proteintech, 31182-1-AP, SLC2A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC2A7 (31182-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A7 in IHC, ELISA applications with reactivity to human, mouse samples\n31182-1-AP targets SLC2A7 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC2A7 (solute carrier family 2 member 7, also known as GLUT7) belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34515 Product name: Recombinant human SLC2A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-281 aa of NM_207420 Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 7\nCalculated Molecular Weight: 512 aa, 56 kDa\nGenBank Accession Number: NM_207420\nGene Symbol: SLC2A7\nGene ID (NCBI): 155184\nRRID: AB_3669886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6PXP3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805943977,"sku":"31182-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31182-1-ap","provider":"Iright","version":"1.0","type":"link"}