{"product_id":"proteintech-31195-1-ap","title":"Proteintech, 31195-1-AP, RAB44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB44 (31195-1-AP) by Proteintech is a Polyclonal antibody targeting RAB44 in WB, ELISA applications with reactivity to human samples\n31195-1-AP targets RAB44 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab44 is a member of the large Rab GTPase family, encoding an N-terminal EF-hand domain, a coiled-coil domain and a C-terminal Rab GTPase domain. It is highly expressed in immune-related cells such as mast cells, macrophages, osteoclasts and granulocyte lineage cells in the bone marrow. In mouse mast cells, Rab44 is expressed as two isoforms, the long and short forms with molecular masses of 180 kDa and 110 kDa (PMID: 33641252).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35126 Product name: Recombinant human RAB44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001257357 Sequence: METGQRTSRKVRKLGSNRRRQTREPADGEGAAVAPEPESWSSQAAAELQAFFQDCGAKERGFVTREDLAVAKFSFLGSKEESEMIFDWVDVERKGHLSLEEFSSGLKNIFGSSQSPHRLRRRKPLPSKRVSATTSFPALEEADAEEKEAF Predict reactive species\nFull Name: RAB44, member RAS oncogene family\nCalculated Molecular Weight: 111 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: NM_001257357\nGene Symbol: RAB44\nGene ID (NCBI): 401258\nRRID: AB_3669894\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7Z6P3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887778418857,"sku":"31195-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31195-1-ap","provider":"Iright","version":"1.0","type":"link"}