{"product_id":"proteintech-31283-1-ap","title":"Proteintech, 31283-1-AP, FNIP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FNIP2 (31283-1-AP) by Proteintech is a Polyclonal antibody targeting FNIP2 in IP, IHC, ELISA applications with reactivity to Human, Mouse samples\n31283-1-AP targets FNIP2 in IP, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFolliculin (FLCN)-interacting proteins 1 and 2 (FNIP1, FNIP2) are homologous binding partners of FLCN, a tumor suppressor for kidney cancer.  FNIP2 was found to bind to the C terminus of FLCN and to AMPK, like FNIP1. FNIP2 competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PMID: 18403135).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35014 Product name: Recombinant human FNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 740-885 aa of BC166693 Sequence: ERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEG Predict reactive species\nFull Name: folliculin interacting protein 2\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: BC166693\nGene Symbol: FNIP2\nGene ID (NCBI): 57600\nRRID: AB_3669929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P278\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887642071209,"sku":"31283-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31283-1-ap","provider":"Iright","version":"1.0","type":"link"}