{"product_id":"proteintech-31329-1-ap","title":"Proteintech, 31329-1-AP, SLC10A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC10A4 (31329-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A4 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n31329-1-AP targets SLC10A4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC10A4 belongs to the solute carrier superfamily and is a protease-activated transporter involved in uptake of bile acid (PMID: 23589386). SLC10A4 is expressed with a high expression in brain and is a vesicular monoaminergic and cholinergic-associated transporter that is important for dopamine homeostasis and neuromodulation (PMID: 25176177).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34358 Product name: Recombinant human SLC10A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 313-437 aa of BC019066 Sequence: ASGYGLATLFHLPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTSL Predict reactive species\nFull Name: solute carrier family 10 (sodium\/bile acid cotransporter family), member 4\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC019066\nGene Symbol: SLC10A4\nGene ID (NCBI): 201780\nRRID: AB_3669945\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96EP9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803158697,"sku":"31329-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31329-1-ap","provider":"Iright","version":"1.0","type":"link"}