{"product_id":"proteintech-31330-1-ap","title":"Proteintech, 31330-1-AP, OSTA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSTA (31330-1-AP) by Proteintech is a Polyclonal antibody targeting OSTA in WB, ELISA applications with reactivity to Human, mouse, rat samples\n31330-1-AP targets OSTA in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue, rat small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC51A also known as OSTA, belongs to the OST-alpha family. SLC51A is an essential component of the Ost-alpha\/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). SLC51A is located in basolateral plasma membrane and transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B. SLC51A is expressed with a high expression in kidney and intestine (PMID: 15563450). Mutations in SLC51A are associated with Cholestasis progressive familial intrahepatic 6(PMID: 31863603).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34517 Product name: Recombinant human SLC51A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-48 aa of NM_152672 Sequence: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP Predict reactive species\nFull Name: organic solute transporter alpha\nCalculated Molecular Weight: 340 aa, 38 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: NM_152672\nGene Symbol: SLC51A\nGene ID (NCBI): 200931\nRRID: AB_3669946\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86UW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869569175721,"sku":"31330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31330-1-ap","provider":"Iright","version":"1.0","type":"link"}