{"product_id":"proteintech-31376-1-ap","title":"Proteintech, 31376-1-AP, SLC15A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC15A5 (31376-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31376-1-AP targets SLC15A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue,  rat kidney tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC15A5 (Solute carrier family 15 member 5) may be involved in peptide transport; protein transport; and transmembrane transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34523 Product name: Recombinant human SLC15A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-579 aa of NM_001170798 Sequence: QRYCNLNHFNAQNIRGSNLEETLLLHEKSLKFYGSIQEFSSSIDLWETAL Predict reactive species\nFull Name: solute carrier family 15, member 5\nCalculated Molecular Weight: 579 aa, 65 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001170798\nGene Symbol: SLC15A5\nGene ID (NCBI): 729025\nRRID: AB_3669958\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A6NIM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803650217,"sku":"31376-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31376-1-ap","provider":"Iright","version":"1.0","type":"link"}