{"product_id":"proteintech-31380-1-ap","title":"Proteintech, 31380-1-AP, COG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COG5 (31380-1-AP) by Proteintech is a Polyclonal antibody targeting COG5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31380-1-AP targets COG5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOG5 (Component Of Oligomeric Golgi Complex 5) is part of an eight-subunit Golgi-resident protein referred to as the conserved oligomeric golgi (COG) complex, which facilitates retrograde Golgi trafficking of vesicles that may include necessary glycosylation enzymes (PMID: 33277529). COG5 knockdown led to marked increases indicative of aberrant glycosylation (PMID: 25331899). The 92- and 87-kDa polypeptides could also be alternatively spliced isoforms of GTC-90 (PMID: 9792665)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35394 Product name: Recombinant human COG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_181733.2 Sequence: MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREI Predict reactive species\nFull Name: component of oligomeric golgi complex 5\nCalculated Molecular Weight: 93kDa，839aa\nObserved Molecular Weight: 87-93 kDa\nGenBank Accession Number: NM_181733.2\nGene Symbol: COG5\nGene ID (NCBI): 10466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UP83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886732398761,"sku":"31380-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31380-1-ap","provider":"Iright","version":"1.0","type":"link"}