{"product_id":"proteintech-31421-1-ap","title":"Proteintech, 31421-1-AP, NDRG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDRG3 (31421-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG3 in WB, IHC, ELISA applications with reactivity to human samples\n31421-1-AP targets NDRG3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Raji cells,  Calu-1 cells,  Ramos cells,  SKOV-3 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDRG (N-Myc downstream-regulated gene) family is generally divided into two subfamilies, one composed of NDRG1 and NDRG3 with a homology of 67%, and the other composed of NDRG2 and NDRG4 with a homology of 58%. NDRG3 is a downstream regulatory factor of MYC, with a total length of 2588 base pairs. It is mainly expressed in ovary, prostate, testis, brain, spinal cord, thymus, heart and kidney. NDRG3 is located on chromosome 20q11.21-11.23 and encodes at least two subtypes, 375 and 363 amino acids, respectively, with an apparent molecular weight of 41 and 40 kDa, respectively. (PMID: 36619553)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33626 Product name: Recombinant human NDRG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-237 aa of NM_032013 Sequence: LSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEI* Predict reactive species\nFull Name: NDRG family member 3\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41-45 kDa\nGenBank Accession Number: NM_032013\nGene Symbol: NDRG3\nGene ID (NCBI): 57446\nRRID: AB_3669974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UGV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733854377,"sku":"31421-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31421-1-ap","provider":"Iright","version":"1.0","type":"link"}