{"product_id":"proteintech-31427-1-ap","title":"Proteintech, 31427-1-AP, C20orf26 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C20orf26 (31427-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf26 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31427-1-AP targets C20orf26 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC20orf26, also known as CFAP61 (cilia and flagella associated protein 61), is a protein-coding gene located on human chromosome 20. The protein is predicted to be involved in cilium movement and cilium organization, and it is likely to be located in the axoneme and motile cilium. CFAP61 is also predicted to colocalize with the radial spoke stalk, which is a part of the structural framework of cilia and flagella.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35425 Product name: Recombinant human C20orf26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-190 aa of BC031674 Sequence: HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE Predict reactive species\nFull Name: chromosome 20 open reading frame 26\nGenBank Accession Number: BC031674\nGene Symbol: C20orf26\nGene ID (NCBI): 26074\nRRID: AB_3669978\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NHU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885569298601,"sku":"31427-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31427-1-ap","provider":"Iright","version":"1.0","type":"link"}