{"product_id":"proteintech-31431-1-ap","title":"Proteintech, 31431-1-AP, GNA12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNA12 (31431-1-AP) by Proteintech is a Polyclonal antibody targeting GNA12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31431-1-AP targets GNA12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG protein subunit alpha 12 (GNA12) is a member of the G12 family of G protein alpha subunits. It has 3 isoforms and is expressed in many tissues including lung, testis and placenta. GNA12\/13-mediated signaling pathways are involved in a variety of physiological processes including cell growth, cell migration, angiogenesis, platelet activation and apoptosis (PMID: 37426201).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein) alpha 12\nObserved Molecular Weight: 37-39 kDa\nGenBank Accession Number: BC087537\nGene Symbol: GNA12\nGene ID (NCBI): 2768\nRRID: AB_3669980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q03113\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887653408937,"sku":"31431-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31431-1-ap","provider":"Iright","version":"1.0","type":"link"}