{"product_id":"proteintech-31435-1-ap","title":"Proteintech, 31435-1-AP, EYA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EYA1 (31435-1-AP) by Proteintech is a Polyclonal antibody targeting EYA1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n31435-1-AP targets EYA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCCIT cells, mouse kidney tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe EYA1 (Eyes absent homolog 1) gene is the human homologue of the Drosophila Eya1 gene, which is essential for eye development in that species. There are 4 different isoforms of EYA1 (EYA1A, EYA1B, EYA1C, EYA1D), which are composed of 559 amino acids (AA), 592 AA, 592 AA and 557 AA, respectively. It should be noted that isoforms B and C have the same length; however, they could be considered different variants because of change in amino acidic composition (PMID: 24803398).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33438 Product name: Recombinant human EYA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-250 aa of BC121799 Sequence: TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTP Predict reactive species\nFull Name: eyes absent homolog 1 (Drosophila)\nCalculated Molecular Weight: 592 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC121799\nGene Symbol: EYA1\nGene ID (NCBI): 2138\nRRID: AB_3669982\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q99502\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628931241,"sku":"31435-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31435-1-ap","provider":"Iright","version":"1.0","type":"link"}