{"product_id":"proteintech-31437-1-ap","title":"Proteintech, 31437-1-AP, SLC8A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC8A2 (31437-1-AP) by Proteintech is a Polyclonal antibody targeting SLC8A2 in IHC, IF-P, ELISA applications with reactivity to human, rat samples\n31437-1-AP targets SLC8A2 in IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC8A2, or solute carrier family 8 member 2,  belongs to the SLC8 gene family, which encodes sodium-calcium exchangers (NCX). These proteins are part of the CaCA (Ca2+\/Cation Antiporter) superfamily and play a significant role in regulating Ca2+-dependent events in many cell types. SLC8A2 has been implicated in various diseases, such as heart failure, arrhythmia, cerebral ischemia, hypertension, diabetes, and muscle dystrophy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34438 Product name: Recombinant human SLC8A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-68 aa of NM_015063 Sequence: AATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDK Predict reactive species\nFull Name: solute carrier family 8 (sodium\/calcium exchanger), member 2\nCalculated Molecular Weight: 921 aa, 100 kDa\nGenBank Accession Number: NM_015063\nGene Symbol: SLC8A2\nGene ID (NCBI): 6543\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UPR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887808041129,"sku":"31437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31437-1-ap","provider":"Iright","version":"1.0","type":"link"}