{"product_id":"proteintech-31471-1-ap","title":"Proteintech, 31471-1-AP, C1orf122 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1orf122 (31471-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf122 in WB, ELISA applications with reactivity to human samples\n31471-1-AP targets C1orf122 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1orf122 (also known as ALAESM) is a lysosomal transmembrane protein and a member of the α\/β hydrolase superfamily. It catalyzes the deacylation of cardiolipin to generate monolysocardiolipin (MLCL) within cells, serving as a key node in the mitochondrial cardiolipin remodeling pathway. Clinical multi-omics studies have revealed its significant overexpression in more than ten types of tumors, including hepatocellular carcinoma, glioma, and gastric cancer, which is closely associated with shorter patient survival, immune infiltration, and activation of DNA damage repair pathways. In vitro experiments have confirmed that it promotes cancer cell proliferation and migration by inhibiting apoptosis, inducing epithelial-mesenchymal transition (EMT), and activating the PI3K\/AKT\/GSK3β-SRPK1 axis. It is regarded as a potential independent prognostic biomarker and therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35685 Product name: Recombinant human C1orf122 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of NM_198446.2 Sequence: MEWGPGSDWSRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP Predict reactive species\nFull Name: chromosome 1 open reading frame 122\nCalculated Molecular Weight: 11kDa，110aa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NM_198446.2\nGene Symbol: C1orf122\nGene ID (NCBI): 127687\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6ZSJ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885511725225,"sku":"31471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31471-1-ap","provider":"Iright","version":"1.0","type":"link"}