{"product_id":"proteintech-31490-1-ap","title":"Proteintech, 31490-1-AP, FAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAT2 (31490-1-AP) by Proteintech is a Polyclonal antibody targeting FAT2 in WB, ELISA applications with reactivity to human samples\n31490-1-AP targets FAT2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAT2 (FAT atypical cadherin 2), also known as CDHF8. The gene product is a member of the cadherin superfamily, a group of integral membrane proteins characterized by the presence of cadherin-type repeats. This protein most likely functions as a cell adhesion molecule, controlling cell proliferation and playing an important role in cerebellum development. Expressed in epidermal keratinocytes, infant brain, cerebellum, and also in a variety of tumors, such as pancreatic cancer, diffuse type gastric cancer, ovarian cancer, esophageal cancer, skin squamous cell carcinoma, head and neck cancer. Not expressed in melanoma cell line A375 cells, normal epidermal melanocytes or normal dermal fibroblasts. Expressed in epidermal keratinocytes and squamous cell carcinoma (at protein level). The molecular weight of FAT2 is 473 kDa. The huge molecular masses (about 500-600 kDa) have hindered studies of the molecular aspects of itself roles(PMID: 15923647).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34942 Product name: Recombinant human FAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-400 aa of NM_001447 Sequence: SGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLAALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHFKAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSLKFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPS Predict reactive species\nFull Name: FAT tumor suppressor homolog 2 (Drosophila)\nCalculated Molecular Weight: 479 kDa\nObserved Molecular Weight: 500-600 kDa\nGenBank Accession Number: NM_001447\nGene Symbol: FAT2\nGene ID (NCBI): 2196\nRRID: AB_3670004\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NYQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635452073,"sku":"31490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31490-1-ap","provider":"Iright","version":"1.0","type":"link"}