{"product_id":"proteintech-31495-1-ap","title":"Proteintech, 31495-1-AP, human IgG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe human IgG3 (31495-1-AP) by Proteintech is a Polyclonal antibody targeting human IgG3 in WB, IHC, ELISA applications with reactivity to human, pig samples\n31495-1-AP targets human IgG3 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig spleen tissue, pig tonsil tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35740 Product name: Recombinant human IGHG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-312 aa of NG_001019.6 Sequence: LHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE Predict reactive species\nFull Name: immunoglobulin heavy constant gamma 3 (G3m marker)\nCalculated Molecular Weight: 49kDa，446aa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: NG_001019.6\nGene Symbol: IGHG3\nGene ID (NCBI): 3502\nRRID: AB_3670007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01860\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887673692329,"sku":"31495-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31495-1-ap","provider":"Iright","version":"1.0","type":"link"}