{"product_id":"proteintech-31522-1-ap","title":"Proteintech, 31522-1-AP, ARSE Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARSE (31522-1-AP) by Proteintech is a Polyclonal antibody targeting ARSE in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31522-1-AP targets ARSE in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARSE (arylsulfatase E), is a member of the sulfatase family. This enzyme is glycosylated post-translationally. Sulfatases, including ARSE, are essential for the correct composition of the bone and cartilage matrix.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24371 Product name: Recombinant human ARSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 524-567 aa of BC130438 Sequence: HILTPASEPVFYQVMERVQQAVWEHQRTLSPVPLQLDRLGNIWR Predict reactive species\nFull Name: arylsulfatase E (chondrodysplasia punctata 1)\nGenBank Accession Number: BC130438\nGene Symbol: ARSE\nGene ID (NCBI): 415\nRRID: AB_3670019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P51690\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885071814825,"sku":"31522-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31522-1-ap","provider":"Iright","version":"1.0","type":"link"}