{"product_id":"proteintech-31523-1-ap","title":"Proteintech, 31523-1-AP, EXOC8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EXOC8 (31523-1-AP) by Proteintech is a Polyclonal antibody targeting EXOC8 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31523-1-AP targets EXOC8 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, mouse testis tissue,  rat testis tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEXOC8 is a subunit of the exocyst complex involved in docking exocytic vesicles with fusion sites on the plasma membrane. Truncated EXOC8 protein leads to the improper assembly of the exocyst complex, thus resulting in the accumulation of neurotransmitters and other excretory vesicles in the cell. It is found to play an essential role in normal cortical development and its perturbation causes complex brain disorders. EXOC8 mutations are linked to neurodevelopmental disorders with microcephaly, seizures, and brain atrophy (PMID: 35460391, PMID: 36344539).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33300 Product name: Recombinant human EXOC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-725 aa of BC035763 Sequence: EATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPESTTSVV Predict reactive species\nFull Name: exocyst complex component 8\nCalculated Molecular Weight: 725 aa, 82 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC035763\nGene Symbol: EXOC8\nGene ID (NCBI): 149371\nRRID: AB_3670020\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IYI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887628734633,"sku":"31523-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31523-1-ap","provider":"Iright","version":"1.0","type":"link"}