{"product_id":"proteintech-31527-1-ap","title":"Proteintech, 31527-1-AP, RBP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBP2 (31527-1-AP) by Proteintech is a Polyclonal antibody targeting RBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31527-1-AP targets RBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue, rat small intestine tissue\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRetinol-binding protein 2 (RBP2) also known as CRBP2, CRBP-II, is an abundant 134-residue protein confined largely to the small intestinal enterocyte. It is thought to participate in the uptake and\/or intracellular metabolism of vitamin A(PMID: 3029082).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35801 Product name: Recombinant human RBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-134 aa of NM_004164.2 Sequence: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK Predict reactive species\nFull Name: retinol binding protein 2, cellular\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: NM_004164.2\nGene Symbol: RBP2\nGene ID (NCBI): 5948\nRRID: AB_3670022\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P50120\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780712617,"sku":"31527-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31527-1-ap","provider":"Iright","version":"1.0","type":"link"}