{"product_id":"proteintech-31542-1-ap","title":"Proteintech, 31542-1-AP, AKAP8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKAP8 (31542-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP8 in WB, ELISA applications with reactivity to Human samples\n31542-1-AP targets AKAP8 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HL-60 cells,  HeLa cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKAP8 (A-kinase anchor protein 8), also called AKAP95, is a A-kinase anchor protein that directs activity of protein kinase A by tethering the enzyme near its physiologic substrates (PMID: 9473338; 10601332). It is associated with chromatin and nuclear matrix which has a remarkable activity in promoting chromatin transcription (PMID: 31980632), and it is also required for cell cycle G2\/M transition and histone deacetylation during mitosis (PMID: 16980585).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35816 Product name: Recombinant human AKAP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 501-692 aa of NM_005858.3 Sequence: SVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE Predict reactive species\nFull Name: A kinase (PRKA) anchor protein 8\nCalculated Molecular Weight: 76kDa，692aa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: NM_005858.3\nGene Symbol: AKAP8\nGene ID (NCBI): 10270\nRRID: AB_3670031\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O43823\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869806284969,"sku":"31542-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31542-1-ap","provider":"Iright","version":"1.0","type":"link"}